PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA21G00538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YB
Protein Properties Length: 178aa    MW: 20380.5 Da    PI: 6.5101
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA21G00538genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1702.7e-5363158297
       NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy++ lk+yl+++r +egek
  AA21G00538  63 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYADHLKKYLNRFRIFEGEK 158
                 89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.2E-5157165IPR009072Histone-fold
SuperFamilySSF471132.17E-3965167IPR009072Histone-fold
PfamPF008087.4E-2868132IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.2E-1896114No hitNo description
PROSITE patternPS00685099115IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.2E-18115133No hitNo description
PRINTSPR006155.2E-18134152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MAGNYPSFQN PIPRFQDYNF ESTSSYNNNN NNHHQEQQYH HHYNYGLRRE DQEEAEESMM  60
MIKEQDRLLP IANVGRIMKN ILPPNAKISK EAKETMQECV SEFISFVTGE ASDKCHKEKR  120
KTVNGDDICW AMANLGFDDY ADHLKKYLNR FRIFEGEKAN HQSKGGGGGG GAKASPDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-4462152191Transcription factor HapC (Eurofung)
4g92_B8e-4462152191Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010506819.12e-87PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822484e-86NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0D3B7553e-85A0A0D3B755_BRAOL; Uncharacterized protein
STRINGAT2G47810.11e-83(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-84nuclear factor Y, subunit B5